| Edit |   |
|---|
| Antigenic Specificity | CES6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CES6 Antibody |
|---|
| Immunogen | The immunogen for anti-CES6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Ces2a, Accession: NM_133960 |
|---|
| Catalog # | TA329985 |
|---|
| Price | |
|---|
| Order / More Info | CES6 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|