| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAH17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAH17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAH17. This antibody reacts with human. The DNAH17 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PWKDYVIYIDDMVLDEFDQFIRKSLSFLMDNMVIDESIAPLFEIRMELDEDGLTFNPTLEVGSDRGFLALIEGLVNDIYNVARLIPRLAKDRMNYKMD |
|---|
| Other Names | axonemal dynein heavy chain, axonemal dynein heavy chain-like protein 1, ciliary dynein heavy chain 17, ciliary dynein heavy chain-like protein 1, DNAHL1, DNEL2, dynein heavy chain 17, axonemal, dynein light chain 2, axonemal, dynein, axonemal, heavy chain 17, dynein, axonemal, heavy chain like 1, dynein, axonemal, heavy like 1, dynein, axonemal, heavy polypeptide 17, FLJ40457, MGC132767, MGC138489 |
|---|
| Gene, Accession # | DNAH17, Gene ID: 8632 |
|---|
| Catalog # | NBP2-62702 |
|---|
| Price | |
|---|
| Order / More Info | DNAH17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|