| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAH11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAH11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAH11. This antibody reacts with human. The DNAH11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNAH11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DCWGYIERVRAATSELEHRVERTQKNVKVIQQTMRGWARCVLPPRREHRREAAFTLEDKGDLFTKKYKLIQGDGCKIHNLVEENRKLFKANPSLDTWKI |
|---|
| Other Names | axonemal, Axonemal beta dynein heavy chain 11, CILD7Dnahc11, Ciliary dynein heavy chain 11, DNAHBLFLJ30095, DNAHC11FLJ37699, DNHBL, dynein, axonemal, heavy chain 11, dynein, axonemal, heavy polypeptide 11, dynein, ciliary, heavy chain 11 |
|---|
| Gene, Accession # | DNAH11, Gene ID: 8701 |
|---|
| Catalog # | NBP2-58536 |
|---|
| Price | |
|---|
| Order / More Info | DNAH11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|