| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNAH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNAH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNAH1. This antibody reacts with human. The DNAH1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNAH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS |
|---|
| Other Names | axonemal beta dynein heavy chain 1, axonemal, heavy polypeptide 1, ciliary dynein heavy chain 1, DNAH1 variant protein, DNAHC1, dynein heavy chain 1, axonemal, dynein, axonemal, heavy chain 1, HDHC7, heat shock regulated 1, HL11, HL-11, HSRF-1 |
|---|
| Gene, Accession # | DNAH1, Gene ID: 25981 |
|---|
| Catalog # | NBP1-90490 |
|---|
| Price | |
|---|
| Order / More Info | DNAH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|