| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EVI-1 |
|---|
| Clone | 1E7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EVI-1 Antibody (1E7) from Novus Biologicals is a mouse monoclonal antibody to EVI-1. This antibody reacts with human. The EVI-1 Antibody (1E7) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MDS1 (NP_004982, 80 a.a. - 169 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS |
|---|
| Other Names | AML1-EVI-1, AML1-EVI-1 fusion protein, ecotropic viral integration site 1, Ecotropic virus integration site 1 protein homolog, EVI-1, EVI1MDS1-EVI1, MDS1, MDS1 and EVI1 complex locus, MDS1 and EVI1 complex locus protein EVI1, MDS1 and EVI1 complex locus protein MDS1, MGC163392, MGC97004, myelodysplasia syndrome 1, Myelodysplasia syndrome 1 protein, Myelodysplasia syndrome-associated protein 1, oncogene EVI1, PRDM3, zinc finger protein Evi1 |
|---|
| Gene, Accession # | MECOM, Gene ID: 2122, Accession: NP_004982, SwissProt: NP_004982 |
|---|
| Catalog # | H00004197-M01 |
|---|
| Price | |
|---|
| Order / More Info | EVI-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|