| Edit |   |
|---|
| Antigenic Specificity | NELF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NELF Antibody from Novus Biologicals is a rabbit polyclonal antibody to NELF. This antibody reacts with human. The NELF Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the N terminal of NELF. Peptide sequence GAAASRRRALRSEAMSSVAAKVRAARAFGEYLSQSHPENRNGADHLLADA. |
|---|
| Other Names | nasal embryonic LHRH factorMGC125369, nasal embryonic luteinizing hormone-releasing hormone factor |
|---|
| Gene, Accession # | NELF, Gene ID: 26012, Accession: Q6X4W1-2, SwissProt: Q6X4W1-2 |
|---|
| Catalog # | NBP1-54813-20ul |
|---|
| Price | |
|---|
| Order / More Info | NELF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|