Edit |   |
Antigenic Specificity | ZNF705D |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF705D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF705D. This antibody reacts with human. The ZNF705D Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the middle region of human LOC728957. Peptide sequence LGQKCYECDKSGKAFSQSSGFRGNKIIHIGEKPHACLLCGKAFSLSSDLR. |
Other Names | MGC131746, putative zinc finger protein 705C, zinc finger protein 705C, zinc finger protein 705D, ZNF705C |
Gene, Accession # | ZNF705D, Gene ID: 728957, Accession: NP_001034704, SwissProt: NP_001034704 |
Catalog # | NBP1-79367 |
Price | |
Order / More Info | ZNF705D Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |