Edit |   |
Antigenic Specificity | ZNF385D |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF385D Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385D. This antibody reacts with human. The ZNF385D Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the C terminal of human ZNF385DThe immunogen for this antibody is ZNF385D. Peptide sequence RHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNP. |
Other Names | FLJ12586, zinc finger protein 329 |
Gene, Accession # | ZNF385D, Gene ID: 79750, Accession: NP_078973, SwissProt: NP_078973 |
Catalog # | NBP1-79398-20ul |
Price | |
Order / More Info | ZNF385D Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |