Edit |   |
Antigenic Specificity | ZNF780B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF780B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF780B. This antibody reacts with human. The ZNF780B Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the N terminal of human ZNF780BThe immunogen for this antibody is ZNF780B. Peptide sequence RWYPDLESKYGPEKISPENDIFEINLPKHVIKQISKTLGLEAFYFRNDSE. |
Other Names | zinc finger protein 780B |
Gene, Accession # | ZNF780B, Gene ID: 163131, Accession: NP_001005851, SwissProt: NP_001005851 |
Catalog # | NBP1-79348 |
Price | |
Order / More Info | ZNF780B Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |