Edit |   |
Antigenic Specificity | ZNF385B |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF385B Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF385B. This antibody reacts with human. The ZNF385B Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the C terminal of human ZNF385BThe immunogen for this antibody is ZNF385B. Peptide sequence HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ. |
Other Names | C2H2-like zinc finger protein rearranged in thyroid adenomas, DKFZp686L0787, KRAB zinc finger protein, zinc finger protein 331, Zinc finger protein 463, ZNF463RITAZNF361Zinc finger protein 361 |
Gene, Accession # | ZNF385B, Gene ID: 151126, Accession: NP_001106869, SwissProt: NP_001106869 |
Catalog # | NBP1-79420-20ul |
Price | |
Order / More Info | ZNF385B Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |