Edit |   |
Antigenic Specificity | ZNF75A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified, no preservative |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF75A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF75A. This antibody reacts with human. The ZNF75A Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the N terminal of human ZNF75A. Peptide sequence FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKLKNDTENHQPVS. |
Other Names | FLJ31529, MGC59959, zinc finger protein 75a |
Gene, Accession # | ZNF75A, Gene ID: 7627, Accession: NP_694573, SwissProt: NP_694573 |
Catalog # | NBP1-80172 |
Price | |
Order / More Info | ZNF75A Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |