Edit |   |
Antigenic Specificity | ZNF90 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ZNF90 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF90. This antibody reacts with human. The ZNF90 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptide directed towards the N terminal of human ZNF90. Peptide sequence KDSFQKVIVTRYEKREYGNLELKKGCESVDEGKVHKRGYNGLNQCLTATQ. |
Other Names | HTF9, zinc finger protein 90 |
Gene, Accession # | ZNF90, Gene ID: 7643 |
Catalog # | NBP1-91427 |
Price | |
Order / More Info | ZNF90 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |