| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | STING/TMEM173 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 25ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The STING/TMEM173 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STING/TMEM173. This antibody reacts with human. The STING/TMEM173 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVY |
|---|
| Other Names | endoplasmic reticulum IFN stimulator, Endoplasmic reticulum interferon stimulator, ERIS, FLJ38577, hMITA, Mediator of IRF3 activation, MITA, mitochondrial mediator of IRF3 activation, MPYS, NET23, N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner, Stimulator of interferon genes protein, sting, STINGhSTING, TMEM173, transmembrane protein 173 |
|---|
| Gene, Accession # | TMEM173, Gene ID: 340061 |
|---|
| Catalog # | NBP2-48684-25ul |
|---|
| Price | |
|---|
| Order / More Info | STING/TMEM173 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|