| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Troponin I type 2 (fast skeletal) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Troponin I type 2 (fast skeletal) Antibody from Novus Biologicals is a rabbit polyclonal antibody to Troponin I type 2 (fast skeletal). This antibody reacts with human. The Troponin I type 2 (fast skeletal) Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Troponin I type 2 (fast skeletal) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSK |
|---|
| Other Names | skeletal, fast, troponin I type 2 (skeletal, fast), troponin I, fast skeletal muscle, Troponin I, fast-twitch isoform, troponin I, fast-twitch skeletal muscle isoform |
|---|
| Gene, Accession # | TNNI2, Gene ID: 7136, Accession: P48788, SwissProt: P48788 |
|---|
| Catalog # | NBP2-38775 |
|---|
| Price | |
|---|
| Order / More Info | Troponin I type 2 (fast skeletal) Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|