| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPPDE2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPPDE2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPPDE2. This antibody reacts with human. The PPPDE2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPPDE2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE |
|---|
| Other Names | D15Wsu75e, DJ347H13.4, FAM152B, family with sequence similarity 152, member B, MGC138384, PPPDE peptidase domain containing 2, PPPDE peptidase domain-containing protein 2, Protein FAM152B |
|---|
| Gene, Accession # | DESI1, Gene ID: 27351 |
|---|
| Catalog # | NBP2-47324 |
|---|
| Price | |
|---|
| Order / More Info | PPPDE2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|