| Edit |   |
|---|
| Antigenic Specificity | PRDM12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRDM12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRDM12. This antibody reacts with mouse. The PRDM12 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Prdm12. Peptide sequence MTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFL. |
|---|
| Other Names | PFM9, PR domain containing 12, PR domain zinc finger protein 12, PR domain-containing protein 12, PR-domain containing protein 12, PR-domain zinc finger protein 12 |
|---|
| Gene, Accession # | PRDM12, Gene ID: 59335, Accession: NP_001116834 |
|---|
| Catalog # | NBP1-79697 |
|---|
| Price | |
|---|
| Order / More Info | PRDM12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|