Edit |   |
Antigenic Specificity | PRAP1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PRAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRAP1. This antibody reacts with human. The PRAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PRAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYH |
Other Names | PRO1195, proline-rich acidic protein 1, RP11-122K13.6, UPAMGC126792, Uterine-specific proline-rich acidic protein |
Gene, Accession # | PRAP1, Gene ID: 118471, Accession: Q96NZ9 |
Catalog # | NBP1-80633 |
Price | |
Order / More Info | PRAP1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |