| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FPRL1/FPR2 |
|---|
| Clone | 2G8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FPRL1/FPR2 Antibody (2G8) from Novus Biologicals is a mouse monoclonal antibody to FPRL1/FPR2. This antibody reacts with human. The FPRL1/FPR2 Antibody (2G8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | FPR2 (AAH29125.1 163 a.a. - 205 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR |
|---|
| Other Names | ALXR, FMLP-R-II, FMLPX, formyl peptide receptor 2, Formyl peptide receptor-like 1RFP, FPR2A, FPRH1FMLP-related receptor I, FPRL1LXA4 receptor, HM63FPRH2, Lipoxin A4 receptor, lipoxin A4 receptor (formyl peptide receptor related), LXA4RFMLP-R-I, N-formyl peptide receptor 2 |
|---|
| Gene, Accession # | FPR2, Gene ID: 2358, Accession: AAH29125, SwissProt: AAH29125 |
|---|
| Catalog # | H00002358-M03 |
|---|
| Price | |
|---|
| Order / More Info | FPRL1/FPR2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|