| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3D |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3D Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3D. This antibody reacts with human. The EIF3D Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human EIF3D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FDLLTVSETANEPPQDEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDID |
|---|
| Other Names | eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translation initiation factor 3, subunit D, MGC126526, MGC17258, translation initiation factor eIF3 p66 subunit |
|---|
| Gene, Accession # | EIF3D, Gene ID: 8664 |
|---|
| Catalog # | NBP2-58658 |
|---|
| Price | |
|---|
| Order / More Info | EIF3D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|