| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EIF3B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EIF3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3B. This antibody reacts with human. The EIF3B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EIF3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PPTLLSQEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKYRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWE |
|---|
| Other Names | eIF3 p110, eIF3 p116, eIF3b, eIF-3-eta, EIF3-P110, EIF3-P116, EIF3S9EIF3-ETA, Eukaryotic translation initiation factor 3 subunit 9, eukaryotic translation initiation factor 3 subunit B, eukaryotic translation initiation factor 3, subunit 9 (eta, 116kD), eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, eukaryotic translation initiation factor 3, subunit B, MGC104664, MGC131875, Prt1 homolog, PRT1hPrt1 |
|---|
| Gene, Accession # | EIF3B, Gene ID: 8662, Accession: P55884, SwissProt: P55884 |
|---|
| Catalog # | NBP2-38597 |
|---|
| Price | |
|---|
| Order / More Info | EIF3B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|