产品详情 |
Edit |   |
Antigenic Specificity | LMOD3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26035871). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The LMOD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMOD3. This antibody reacts with human, mouse. The LMOD3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LMOD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK |
Other Names | DKFZp313F0135, leiomodin 3 (fetal), Leiomodin, fetal form, leiomodin-3 |
Gene, Accession # | LMOD3, Gene ID: 56203, Accession: Q0VAK6, SwissProt: Q0VAK6 |
Catalog # | NBP1-85898 |
Price | |
Order / More Info | LMOD3 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 26035871 |
产品资料 |
|
|