| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HIF-2 alpha/EPAS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIF-2 alpha/EPAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIF-2 alpha/EPAS1. This antibody reacts with human. The HIF-2 alpha/EPAS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HIF-2 alpha/EPAS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG |
|---|
| Other Names | Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, bHLHe73ECYT4, Class E basic helix-loop-helix protein 73, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS-1, HIF-1alpha-like factor, HIF-2 alpha, HIF2A, hif2a angiogenesis, HIF2AHIF-2-alpha, HLFHIF-1-alpha-like factor, hypoxia-inducible factor 2 alpha, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, MOP2HIF2-alpha, PASD2PAS domain-containing protein 2 |
|---|
| Gene, Accession # | EPAS1, Gene ID: 2034 |
|---|
| Catalog # | NBP2-58653 |
|---|
| Price | |
|---|
| Order / More Info | HIF-2 alpha/EPAS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|