产品详情 |
Edit |   |
Antigenic Specificity | HIF-2 alpha/EPAS1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The HIF-2 alpha/EPAS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIF-2 alpha/EPAS1. This antibody reacts with human. The HIF-2 alpha/EPAS1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP |
Other Names | Basic-helix-loop-helix-PAS protein MOP2, BHLHE73, bHLHe73ECYT4, Class E basic helix-loop-helix protein 73, endothelial PAS domain protein 1, endothelial PAS domain-containing protein 1, EPAS-1, HIF-1alpha-like factor, HIF-2 alpha, HIF2A, hif2a angiogenesis, HIF2AHIF-2-alpha, HLFHIF-1-alpha-like factor, hypoxia-inducible factor 2 alpha, Hypoxia-inducible factor 2-alpha, Member of PAS protein 2, MOP2HIF2-alpha, PASD2PAS domain-containing protein 2 |
Gene, Accession # | EPAS1, Gene ID: 2034 |
Catalog # | NBP2-76564 |
Price | |
Order / More Info | HIF-2 alpha/EPAS1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|