Edit |   |
Antigenic Specificity | OXNAD1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The OXNAD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OXNAD1. This antibody reacts with human. The OXNAD1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human OXNAD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFD |
Other Names | MGC15763, oxidoreductase NAD-binding domain containing 1, oxidoreductase NAD-binding domain-containing protein 1 |
Gene, Accession # | OXNAD1, Gene ID: 92106 |
Catalog # | NBP2-58060 |
Price | |
Order / More Info | OXNAD1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |