| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FOXS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FOXS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOXS1. This antibody reacts with human. The FOXS1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human FOXS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTRQTGAEGTRGPAKARRGPLRATSQDPGVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPK |
|---|
| Other Names | FKHL18, forkhead (Drosophila)-like 18, forkhead box protein S1, forkhead box S1, Forkhead-like 18 protein, forkhead-related activator 10, Forkhead-related transcription factor 10, forkhead-related transcription factor FREAC-10, FREAC-10, FREAC10forkhead-like 18 (Drosophila), MGC4544 |
|---|
| Gene, Accession # | FOXS1, Gene ID: 2307 |
|---|
| Catalog # | NBP1-91911 |
|---|
| Price | |
|---|
| Order / More Info | FOXS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|