| Edit |   |
|---|
| Antigenic Specificity | FOXRED1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FOXRED1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOXRED1. This antibody reacts with human. The FOXRED1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FOXRED1(FAD-dependent oxidoreductase domain containing 1) The peptide sequence was selected from the N terminal of FOXRED1. Peptide sequence SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK. |
|---|
| Other Names | FAD-dependent oxidoreductase domain containing 1, FAD-dependent oxidoreductase domain-containing protein 1, H17 |
|---|
| Gene, Accession # | FOXRED1, Gene ID: 55572, Accession: Q96CU9, SwissProt: Q96CU9 |
|---|
| Catalog # | NBP1-57478-20ul |
|---|
| Price | |
|---|
| Order / More Info | FOXRED1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|