产品详情 |
Edit |   |
Antigenic Specificity | PPP2R3A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PPP2R3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP2R3A. This antibody reacts with human. The PPP2R3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. This product is specific to Subunit or Isoform: B |
Immunogen | Synthetic peptides corresponding to PPP2R3A(protein phosphatase 2 (formerly 2A), regulatory subunit B'', alpha) The peptide sequence was selected from the N terminal of PPP2R3A. Peptide sequence SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDN |
Other Names | PP2A subunit B isoform R3 isoform, PP2A subunit B isoforms B72/B130, PP2A subunit B isoforms B'-PR72/PR130, protein phosphatase 2 (formerly 2A), regulatory subunit B' (PR 72), alphaisoform and (PR 130), beta isoform, protein phosphatase 2 (formerly 2A), regulatory subunit B', alpha, protein phosphatase 2, regulatory subunit B', alpha, serine/threonine-protein phosphatase 2A regulatory subunit B' subunit alpha, subunit B, R3 isoform |
Gene, Accession # | PPP2R3A, Gene ID: 5523, Accession: Q06190, SwissProt: Q06190 |
Catalog # | NBP1-54581 |
Price | |
Order / More Info | PPP2R3A Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|