| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP1R16A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R16A Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R16A. This antibody reacts with human. The PPP1R16A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPP1R16A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFPPSVVLLEAAARNDLEEVRQFLGSGVSPDLANE |
|---|
| Other Names | likley ortholog of mouse myosin phosphatase targeting subunit 3, Myosin phosphatase-targeting subunit 3, MYPT3MGC14333, protein phosphatase 1 regulatory subunit 16A, protein phosphatase 1, regulatory (inhibitor) subunit 16A |
|---|
| Gene, Accession # | PPP1R16A, Gene ID: 84988 |
|---|
| Catalog # | NBP1-82750 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R16A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|