| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP4R1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 26472971). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP4R1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP4R1. This antibody reacts with human. The PPP4R1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP4R1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDAHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQ |
|---|
| Other Names | MEG1, PP4R1PP4(Rmeg), protein phosphatase 4, regulatory subunit 1, serine/threonine phosphatase 4, serine/threonine-protein phosphatase 4 regulatory subunit 1 |
|---|
| Gene, Accession # | PPP4R1, Gene ID: 9989 |
|---|
| Catalog # | NBP1-87241 |
|---|
| Price | |
|---|
| Order / More Info | PPP4R1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26300649, 26472971 |
|---|
| 产品资料 |
|
|