| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPP1R7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPP1R7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPP1R7. This antibody reacts with human. The PPP1R7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PPP1R7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF |
|---|
| Other Names | Protein phosphatase 1 regulatory subunit 22, protein phosphatase 1 regulatory subunit 7, protein phosphatase 1, regulatory (inhibitor) subunit 7, protein phosphatase-1 regulatory subunit 7 alpha2, protein phosphatase-1 regulatory subunit 7 beta1, protein phosphatase-1 regulatory subunit 7 beta2, regulatory subunit 7, sds22 |
|---|
| Gene, Accession # | PPP1R7, Gene ID: 5510, Accession: Q15435, SwissProt: Q15435 |
|---|
| Catalog # | NBP2-38207 |
|---|
| Price | |
|---|
| Order / More Info | PPP1R7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|