| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | eIF2B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The eIF2B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to eIF2B1. This antibody reacts with human. The eIF2B1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
|---|
| Immunogen | Synthetic peptides corresponding to EIF2B1(eukaryotic translation initiation factor 2B, subunit 1 alpha) The peptide sequence was selected from the C terminal of EIF2B1. Peptide sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKL. |
|---|
| Other Names | EIF2B, EIF-2B, eIF-2B GDP-GTP exchange factor subunit alpha, EIF-2Balpha, EIF2BAMGC117409, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD), eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa, MGC125868, MGC125869, translation initiation factor eIF-2B subunit alpha |
|---|
| Gene, Accession # | EIF2B1, Gene ID: 1967, Accession: Q14232, SwissProt: Q14232 |
|---|
| Catalog # | NBP1-57644-20ul |
|---|
| Price | |
|---|
| Order / More Info | eIF2B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|