Edit |   |
Antigenic Specificity | LMF2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The LMF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMF2. This antibody reacts with human. The LMF2 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to LMF2(lipase maturation factor 2) The peptide sequence was selected from the middle region of LMF2. Peptide sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS. |
Other Names | lipase maturation factor 2, TMEM153, Transmembrane protein 112BTransmembrane protein 153TMEM112B |
Gene, Accession # | LMF2, Gene ID: 91289, Accession: Q9BU23, SwissProt: Q9BU23 |
Catalog # | NBP1-59374 |
Price | |
Order / More Info | LMF2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |