| Edit |   |
|---|
| Antigenic Specificity | LMF2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LMF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMF2. This antibody reacts with human. The LMF2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to LMF2(lipase maturation factor 2) The peptide sequence was selected from the middle region of LMF2. Peptide sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLGGRPEVVLEGS. |
|---|
| Other Names | lipase maturation factor 2, TMEM153, Transmembrane protein 112BTransmembrane protein 153TMEM112B |
|---|
| Gene, Accession # | LMF2, Gene ID: 91289, Accession: Q9BU23, SwissProt: Q9BU23 |
|---|
| Catalog # | NBP1-59374-20ul |
|---|
| Price | |
|---|
| Order / More Info | LMF2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|