| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LMBR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LMBR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LMBR1. This antibody reacts with human. The LMBR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LMBR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN |
|---|
| Other Names | ACHPchromosome 7 open reading frame 2, C7orf2FLJ11665, DIF14, Differentiation-related gene 14 protein, limb region 1 homolog (mouse), limb region 1 protein homolog, PPD2, TPT |
|---|
| Gene, Accession # | LMBR1, Gene ID: 64327 |
|---|
| Catalog # | NBP1-89276 |
|---|
| Price | |
|---|
| Order / More Info | LMBR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|