Edit |   |
Antigenic Specificity | RAB11FIP2 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The RAB11FIP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB11FIP2. This antibody reacts with human. The RAB11FIP2 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to RAB11FIP2 (RAB11 family interacting protein 2 (class I)) The peptide sequence was selected from the N terminal of RAB11FIP2. Peptide sequence LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF. |
Other Names | KIAA0941RAB11-FIP2 long isoform, nRip11, RAB11 family interacting protein 2 (class I), rab11 family-interacting protein 2, Rab11-FIP2NRip11 |
Gene, Accession # | RAB11FIP2, Gene ID: 22841, Accession: Q7L804, SwissProt: Q7L804 |
Catalog # | NBP1-57009-20ul |
Price | |
Order / More Info | RAB11FIP2 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | PubMed: 30659120 |