Edit |   |
Antigenic Specificity | RAB6C |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The RAB6C Antibody from Novus Biologicals is a rabbit polyclonal antibody to RAB6C. This antibody reacts with human. The RAB6C Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to the middle region of RAB6C. Immunizing peptide sequence DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF. |
Other Names | RAB6C, member RAS oncogene family, ras-related protein Rab-6C, WTH3Rab6-like protein WTH3 |
Gene, Accession # | RAB6C, Gene ID: 84084, Accession: Q9H0N0, SwissProt: Q9H0N0 |
Catalog # | NBP1-74265-20ul |
Price | |
Order / More Info | RAB6C Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |