Edit |   |
Antigenic Specificity | Lebercilin |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The Lebercilin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Lebercilin. This antibody reacts with human. The Lebercilin Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to Lebercilin. The peptide sequence was selected from the N terminal of Lebercilin. Peptide sequence FSLQKLKEISEARHLPERDDLAKKLVSAELKLDDTERRIKELSKNLELST. |
Other Names | C6orf152Leber congenital amaurosis 5 protein, chromosome 6 open reading frame 152, Leber congenital amaurosis 5, Lebercilin |
Gene, Accession # | LCA5, Gene ID: 167691, Accession: Q86VQ0, SwissProt: Q86VQ0 |
Catalog # | NBP1-55416-20ul |
Price | |
Order / More Info | Lebercilin Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |