| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Kanadaptin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Kanadaptin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Kanadaptin. This antibody reacts with human. The Kanadaptin Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Kanadaptin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TWGMGEDAVEDDAEENPIVLEFQQEREAFYIKDPKKALQGFFDREGEELEYEFDEQGHSTWLCRVRLPVDDSTGKQLVAEAIHSGKK |
|---|
| Other Names | FLJ10624, FLJ41004, HLC3, HLC-3, Human lung cancer oncogene 3 protein, kanadaptin, Kidney anion exchanger adapter protein, kidney anion exchanger adaptor protein, lung cancer oncogene 3, MGC120646, MGC120648, solute carrier family 4 (anion exchanger), member 1, adapter protein, solute carrier family 4 (anion exchanger), member 1, adaptor protein, Solute carrier family 4 anion exchanger member 1 adapter protein |
|---|
| Gene, Accession # | SLC4A1AP, Gene ID: 22950, Accession: Q9BWU0, SwissProt: Q9BWU0 |
|---|
| Catalog # | NBP2-38315 |
|---|
| Price | |
|---|
| Order / More Info | Kanadaptin Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|