| Edit |   |
|---|
| Antigenic Specificity | ARHGAP30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARHGAP30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP30. This antibody reacts with human. The ARHGAP30 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ARHGAP30The immunogen for this antibody is ARHGAP30. Peptide sequence RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG. |
|---|
| Other Names | Rho GTPase activating protein 30 |
|---|
| Gene, Accession # | ARHGAP30, Gene ID: 257106, Accession: NP_001020769, SwissProt: NP_001020769 |
|---|
| Catalog # | NBP1-79547-20ul |
|---|
| Price | |
|---|
| Order / More Info | ARHGAP30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|