Edit |   |
Antigenic Specificity | ARHGAP27 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 100 ul |
Concentration | n/a |
Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ARHGAP27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARHGAP27. This antibody reacts with human. The ARHGAP27 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human ARHGAP27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PRSIHKSSQDGDTPAQASPPEEKVPAELDEVGSWEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKEHWSAS |
Other Names | Rho GTPase activating protein 27 |
Gene, Accession # | ARHGAP27, Gene ID: 201176 |
Catalog # | NBP2-55668 |
Price | |
Order / More Info | ARHGAP27 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |