| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TFF1/pS2 |
|---|
| Clone | pS2.1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein G purified |
|---|
| Size | 500 ul |
|---|
| Concentration | 0.2 mg/ml |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence. May be useful in IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TFF1/pS2 Antibody (pS2.1) from Novus Biologicals is a mouse monoclonal antibody to TFF1/pS2. This antibody reacts with human. The TFF1/pS2 Antibody (pS2.1) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunofluorescence. |
|---|
| Immunogen | A Synthetic 31-mer peptide aa 54-84 (KGCCFDDTVRGVPWCFYPNTIDVPPEEECEF) from the C-terminus of human pS2 protein |
|---|
| Other Names | BCEIbreast cancer, estrogen-inducible sequence expressed in, Breast cancer estrogen-inducible protein, breast cancer estrogen-inducible sequence, D21S21, gastrointestinal trefoil protein pS2, hP1.A, HPS2, pNR-2, Polypeptide P1.A, Protein pS2, pS2, trefoil factor 1, trefoil factor, BCE1, human pS2 induced by estrogen from human breast cancercell line M10HP1.A |
|---|
| Gene, Accession # | TFF1, Gene ID: 7031 |
|---|
| Catalog # | NB120-3079-500uL |
|---|
| Price | |
|---|
| Order / More Info | TFF1/pS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|