Edit |   |
Antigenic Specificity | Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Transglutaminases are enzymes that catalyze the crosslinking of proteins by epsilon-gamma glutamyl lysine isopeptide bonds. While the primary structure of transglutaminases is not conserved, they all have the same amino acid sequence at their active sites and their activity is calcium-dependent. TGM2 acts as a monomer, is induced by retinoic acid, and appears to be involved in apoptosis. |
Immunogen | Transglutaminase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY |
Other Names | G-ALPHA-h|GNAH|TG2|TGC|TGL2|G[a]h|TGase2|tTG|tTGas|TgaseII|TGM2|fc12b04|wu:fc12b04|zgc:136700 |
Gene, Accession # | Gene ID: 7052 |
Catalog # | ABIN634623 |
Price | |
Order / More Info | Transglutaminase 2 (C Polypeptide, Protein-Glutamine-gamma-Glutamyltransferase) (TGM2) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |