Edit |   |
Antigenic Specificity | PRRC1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 20ul |
Concentration | n/a |
Applications | Western Blot |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PRRC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRRC1. This antibody reacts with human. The PRRC1 Antibody has been validated for the following applications: Western Blot. |
Immunogen | Synthetic peptides corresponding to PRRC1(proline-rich coiled-coil 1) The peptide sequence was selected from the middle region of PRRC1 (NP_570721). Peptide sequence VGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIA. |
Other Names | proline-rich coiled-coil 1 |
Gene, Accession # | PRRC1, Gene ID: 133619, Accession: Q96M27, SwissProt: Q96M27 |
Catalog # | NBP1-70687-20ul |
Price | |
Order / More Info | PRRC1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |