| Edit |   |
|---|
| Antigenic Specificity | Ankyrin repeat domain 39 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ankyrin repeat domain 39 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ankyrin repeat domain 39. This antibody reacts with human. The Ankyrin repeat domain 39 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human ANKRD39. Peptide sequence IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL. |
|---|
| Other Names | ankyrin repeat domain 39, ankyrin repeat domain-containing protein 39, MGC41816 |
|---|
| Gene, Accession # | ANKRD39, Gene ID: 51239, Accession: NP_057550, SwissProt: NP_057550 |
|---|
| Catalog # | NBP1-79652-20ul |
|---|
| Price | |
|---|
| Order / More Info | Ankyrin repeat domain 39 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|