| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | P2Y10/P2RY10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The P2Y10/P2RY10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to P2Y10/P2RY10. This antibody reacts with human. The P2Y10/P2RY10 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human P2Y10/P2RY10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MASEFRDQLSRHGSSVTRSRLMSKESGSSMIG |
|---|
| Other Names | G-protein coupled purinergic receptor P2Y10, P2Y purinoceptor 10, P2Y10P2Y-like receptor, purinergic receptor P2Y, G-protein coupled, 10, putative P2Y purinoceptor 10 |
|---|
| Gene, Accession # | P2RY10, Gene ID: 27334 |
|---|
| Catalog # | NBP2-56283 |
|---|
| Price | |
|---|
| Order / More Info | P2Y10/P2RY10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|