| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL. This antibody reacts with human. The Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLPDGSEIPLPPILLGRLGSDPQKKTVCI |
|---|
| Other Names | CN2cytosolic non-specific dipeptidase, CNDP dipeptidase 2, CNDP dipeptidase 2 (metallopeptidase M20 family), CPGLcytosolic nonspecific dipeptidase, FLJ10830, HsT2298, PEPAEC 3.4.13.18, Peptidase AGlutamate carboxypeptidase-like protein 1 |
|---|
| Gene, Accession # | CNDP2, Gene ID: 55748, Accession: Q96KP4, SwissProt: Q96KP4 |
|---|
| Catalog # | NBP2-38337 |
|---|
| Price | |
|---|
| Order / More Info | Cytosol Nonspecific Dipeptidase (CNDP2)/CPGL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|