Edit |   |
Antigenic Specificity | ANKUB1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The ANKUB1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKUB1. This antibody reacts with human. The ANKUB1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human C3orf16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQ |
Other Names | ANKUB1, Ankyrin Repeat And Ubiquitin Domain Containing 1, C3orf16, Chromosome 3 Open Reading Frame 16, Protein ANKUB1 |
Gene, Accession # | ANKUB1, Gene ID: 389161, Accession: A6NFN9, SwissProt: A6NFN9 |
Catalog # | NBP2-30502 |
Price | |
Order / More Info | ANKUB1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |