Edit |   |
Antigenic Specificity | HPRG |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The HPRG Antibody from Novus Biologicals is a rabbit polyclonal antibody to HPRG. This antibody reacts with human. The HPRG Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human HPRG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG |
Other Names | DKFZp779H1622, Histidine-proline-rich glycoprotein, histidine-rich glycoprotein, HPRGHRGP |
Gene, Accession # | HRG, Gene ID: 3273, Accession: P04196, SwissProt: P04196 |
Catalog # | NBP2-33594 |
Price | |
Order / More Info | HPRG Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |