Edit |   |
Antigenic Specificity | GREB1L |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The GREB1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to GREB1L. This antibody reacts with human. The GREB1L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GREB1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLIIRVPSVQLAMLAKER |
Other Names | C18orf6, GREB1-Like Protein, Growth Regulation By Estrogen In Breast Cancer-Like, KIAA1772 |
Gene, Accession # | GREB1L, Gene ID: 80000, Accession: Q9C091, SwissProt: Q9C091 |
Catalog # | NBP2-33415 |
Price | |
Order / More Info | GREB1L Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |