| Edit |   |
|---|
| Antigenic Specificity | GREB1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GREB1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to GREB1L. This antibody reacts with human. The GREB1L Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GREB1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MVNTLLERYPRLHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLIIRVPSVQLAMLAKER |
|---|
| Other Names | C18orf6, GREB1-Like Protein, Growth Regulation By Estrogen In Breast Cancer-Like, KIAA1772 |
|---|
| Gene, Accession # | GREB1L, Gene ID: 80000, Accession: Q9C091, SwissProt: Q9C091 |
|---|
| Catalog # | NBP2-33415 |
|---|
| Price | |
|---|
| Order / More Info | GREB1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|