| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GRB2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRB2. This antibody reacts with human. The GRB2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human GRB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV |
|---|
| Other Names | abundant SRC homology, Adapter protein GRB2, ASH, EGFRBP-GRB2, epidermal growth factor receptor-binding protein GRB2, Grb3-3, growth factor receptor-bound protein 2, growth factor receptor-bound protein 3, HT027, MST084, MSTP084, NCKAP2, Protein Ash, SH2/SH3 adapter GRB2 |
|---|
| Gene, Accession # | GRB2, Gene ID: 2885 |
|---|
| Catalog # | NBP2-55209 |
|---|
| Price | |
|---|
| Order / More Info | GRB2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|